Protein Info for Atu0357 in Agrobacterium fabrum C58

Annotation: phosphate starvation inducible protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF02562: PhoH" amino acids 134 to 337 (204 residues), 310 bits, see alignment E=1e-96 PF13604: AAA_30" amino acids 140 to 291 (152 residues), 33.3 bits, see alignment E=6.1e-12 PF13245: AAA_19" amino acids 150 to 290 (141 residues), 29.9 bits, see alignment E=8.5e-11

Best Hits

KEGG orthology group: K06217, phosphate starvation-inducible protein PhoH and related proteins (inferred from 100% identity to atu:Atu0357)

Predicted SEED Role

"Phosphate starvation-inducible protein PhoH, predicted ATPase" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1M1 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Atu0357 phosphate starvation inducible protein (Agrobacterium fabrum C58)
MNAHELVSNPSRQPRQAATDANHFVLTFENNRIAGELFGQFDQNLKLLEQRLNIDARPRG
NSVAITGDVVATNQARRALDFLYERLLKGGTAEASDVEGAIRMAMAADDQLTLPTMERKA
KISMAQISTRKKTIAARTPTQDVYMRALEQSELVFGVGPAGTGKTYLAVAHAAQLLERGA
VDRIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDALYDMMPGDKVERAIQAGVIEIA
PLAFMRGRTLANAAVILDEAQNTTTMQMKMFLTRLGENGRMIVTGDPSQVDLPRGVKSGL
VEALQILPEVEGVSVVRFKDVDVVRHPMVARIVRAYESHTAVPDESLPKGN