Protein Info for Atu0338 in Agrobacterium fabrum C58

Annotation: integration host factor, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 PF00216: Bac_DNA_binding" amino acids 1 to 91 (91 residues), 107.2 bits, see alignment E=4.3e-35 TIGR00988: integration host factor, beta subunit" amino acids 1 to 92 (92 residues), 138.3 bits, see alignment E=4.1e-45 PF18291: HU-HIG" amino acids 14 to 60 (47 residues), 28 bits, see alignment E=2e-10

Best Hits

Swiss-Prot: 100% identical to IHFB_AGRFC: Integration host factor subunit beta (ihfB) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K05788, integration host factor subunit beta (inferred from 100% identity to agr:AGROH133_03505)

Predicted SEED Role

"Integration host factor beta subunit" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UIF9 at UniProt or InterPro

Protein Sequence (100 amino acids)

>Atu0338 integration host factor, beta subunit (Agrobacterium fabrum C58)
MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRS
GRNPRTGESVFVEEKWVPFFKTGKELRERLNPGMGDEEDD