Protein Info for Atu0328 in Agrobacterium fabrum C58

Annotation: heat-inducible transcription repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00331: heat-inducible transcription repressor HrcA" amino acids 16 to 358 (343 residues), 351.1 bits, see alignment E=4.3e-109 PF01628: HrcA" amino acids 121 to 345 (225 residues), 195.7 bits, see alignment E=5.1e-62

Best Hits

Swiss-Prot: 100% identical to HRCA_AGRFC: Heat-inducible transcription repressor HrcA (hrcA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03705, heat-inducible transcriptional repressor (inferred from 100% identity to atu:Atu0328)

Predicted SEED Role

"Heat-inducible transcription repressor HrcA" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A3I8 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Atu0328 heat-inducible transcription repressor (Agrobacterium fabrum C58)
MGFSAPLSKDQASLLDERSREIFRRIVEGYLDTGEPLGSRSLSRLLPMSLSPASVRNVMS
DLEELGLIYSPHISAGRLPTQTGLRFFVDAFMQVGDLPADERANIDRQIGPVAGHEQSLE
GLLTEASRMLSGMSRGAGLVLTAKNDVILKHVEFIRLEPTKALAVLVGDHNQVENRIIEL
PAGISSSQLTEAANFINAHLSGQTLQELRGQFQTQRTELQSELGMLAQDLVERGLAIWAG
DNEEGKLGRLIVRGRSNLLEGLAGEEDIDRVRMLFDDLERKENLIEILNLAESGSGVRIF
IGSENKLFSLSGSSLIVAPYRDEENRVVGAVGVIGPTRLNYARIVPMVDYTAQIMARLSR
KQR