Protein Info for Atu0312 in Agrobacterium fabrum C58

Annotation: cysteine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 TIGR01136: cysteine synthase" amino acids 16 to 317 (302 residues), 432.7 bits, see alignment E=7.6e-134 TIGR01139: cysteine synthase A" amino acids 16 to 317 (302 residues), 446.7 bits, see alignment E=3.9e-138 PF00291: PALP" amino acids 16 to 305 (290 residues), 259.3 bits, see alignment E=2.4e-81

Best Hits

Swiss-Prot: 63% identical to CYSK_SYNY3: Cysteine synthase (cysK) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01738, cysteine synthase A [EC: 2.5.1.47] (inferred from 100% identity to atu:Atu0312)

MetaCyc: 59% identical to O-acetylserine (thiol) lyase (Arabidopsis thaliana col)
Cysteine synthase. [EC: 2.5.1.47]

Predicted SEED Role

"Cysteine synthase (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.5.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.47

Use Curated BLAST to search for 2.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKE4 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Atu0312 cysteine synthase (Agrobacterium fabrum C58)
MPEARKPGRGRVYSSITETIGDTPIVRLDKLAKEKGVKANLLAKLEFFNPIGSVKDRIGV
AMIEALEAQGKITPGKTTLVEPTSGNTGIALAFAAAAKGYKLILTMPETMSVERRKMLAL
LGAELVLTEGPKGMKGAIAKAQELAETLPDAVIPQQFENPANPDIHRRTTAEEIWNDTDG
TVDILVSGIGTGGTITGTGQVLKSRKPEVKVIAVEPADSPVLSGGNPGPHKIQGIGAGFA
PAILDTGVYDEIVTVTNDEAFEIARLAARLEGVPVGISSGAALAAAIKVGAREENAGKNI
VVIIPSFAERYLSTALFEGLGL