Protein Info for Atu0306 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (sn-Glycerol-3-phosphate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 168 to 185 (18 residues), see Phobius details amino acids 202 to 226 (25 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 291 (206 residues), 34.7 bits, see alignment E=7.7e-13

Best Hits

KEGG orthology group: K05814, sn-glycerol 3-phosphate transport system permease protein (inferred from 100% identity to atu:Atu0306)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKE6 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Atu0306 ABC transporter, membrane spanning protein (sn-Glycerol-3-phosphate) (Agrobacterium fabrum C58)
MKRVQFSSSYVPYLFLAPQLAVIFIFFYWPSVQAVQSSFYIEDPFGFAASFVGFANYSDA
IFNPEYLSIAKFTVVFTVLVTFFSLALGLLLAVKADAVIRGSSTYKTLLISVYAIAPPVA
GLIGMMLFDQHIGPFVKLAAVFGWDMKVGLNYFDTATAMIVVAVWKQIPYNFIFFLSGLQ
GVSVSVREAAAIDCRSGFRRFWTVIMPLLAPTAFFLLIINITYALFDTFGVIDVMVKDKA
ADNPITLVYKVFLDGFRGNDIGGSSAQSVILMLVVFVLTVIQFRFIEKRVHYN