Protein Info for Atu0294 in Agrobacterium fabrum C58

Annotation: undecaprenyl pyrophosphate phosphatase, possible bacitracin resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 44 to 63 (20 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 149 to 175 (27 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 250 to 267 (18 residues), see Phobius details PF02673: BacA" amino acids 9 to 259 (251 residues), 264 bits, see alignment E=8.6e-83 TIGR00753: undecaprenyl-diphosphatase UppP" amino acids 9 to 257 (249 residues), 230.4 bits, see alignment E=1.5e-72

Best Hits

Swiss-Prot: 100% identical to UPPP1_AGRFC: Undecaprenyl-diphosphatase 1 (uppP1) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 100% identity to atu:Atu0294)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.27

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P58740 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Atu0294 undecaprenyl pyrophosphate phosphatase, possible bacitracin resistance protein (Agrobacterium fabrum C58)
MGDQSIISALLLGIIEGLTEFIPVSSTAHVLLAGHFLGFKSPGNTFAVLIQLGAILAILL
VYFQKLVSIAVAMPTSAKARRFVLAVLVAFLPAAVIGALAHDFIKTVLFETPMLICVVLI
IGGFILLAVDRMPLKPKYTDIMDYPPSLAFKIGLFQCLAMIPGTSRSGATIVGALLMGTD
KRSAAEFSFFLAMPTMLGAFVLDLYKNRDALSFDDSALIAVGFVAAFVSGLFVVRSLLDF
VSRRGFAPFAWWRIVIGALGLVALLVIG