Protein Info for Atu0292 in Agrobacterium fabrum C58

Annotation: iron-sulfur cluster binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR00276: epoxyqueuosine reductase" amino acids 1 to 295 (295 residues), 405.2 bits, see alignment E=9.7e-126 PF08331: QueG_DUF1730" amino acids 11 to 87 (77 residues), 77.2 bits, see alignment E=7.4e-26 PF13484: Fer4_16" amino acids 139 to 203 (65 residues), 82.6 bits, see alignment E=2.7e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0292)

Predicted SEED Role

"Epoxyqueuosine (oQ) reductase QueG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKF3 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Atu0292 iron-sulfur cluster binding protein (Agrobacterium fabrum C58)
MAWMEETEARRAEPKTLWGDVRSIVMFGLNYGPDEDPRGLLSKPDKAAISVYARNRDYHD
IIKGRLKEIATRFAARAGEDVKVFVDTAPVMEKPLAAAAGLGWQGKHTNLVSRSHGSWLF
LGSMFTTAELCVDEAERDHCGSCRACLDACPTAAFPAPYQLDARRCISYLTIEHKGPIPH
EFRPMIGNRIYGCDDCLAACPWNKFAASASEMKLKAREDLKEPSIAFLLTLDDAAFRSFF
SGSPVKRIGRNRFIRNVLIAAGNSADRHFVEQCKALAEADPSAEVRGMAAWALSRLMDRD
EFRTYSAGRAPETDPEAEMEWQLAEA