Protein Info for Atu0274 in Agrobacterium fabrum C58

Annotation: aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 PF02073: Peptidase_M29" amino acids 10 to 411 (402 residues), 546.7 bits, see alignment E=1.6e-168

Best Hits

Swiss-Prot: 54% identical to AMPT_THET8: Aminopeptidase T (TTHA1152) from Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)

KEGG orthology group: K01269, aminopeptidase [EC: 3.4.11.-] (inferred from 100% identity to atu:Atu0274)

Predicted SEED Role

"Aminopeptidase S (Leu, Val, Phe, Tyr preference) (EC 3.4.11.24)" (EC 3.4.11.24)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.- or 3.4.11.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKG8 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Atu0274 aminopeptidase (Agrobacterium fabrum C58)
MTVSPIDPVKLEKLAEVAIKVGLQLQKDQDLVITAPLAALPLVRLLTKHAYIAGGGLVTT
FYSDEETTLSRYRHASDANFDRASGWLYEGMAKAYANGAARLAIAGDNPMLLAEEDPAKV
ARANKANSTAYKPALEKISNFDINWNIISYPNPSWAKQVFPGLTEDEAVRKLADAIFAAS
RVDVADPVAAWAQHNANLAKRSAWLNGERFSALHFTGPGTDVKIGLADGHEWHGGASMAK
NGVTCNPNIPTEEVFTTPHALRVDGYVSSTKPLSHQGTLIDDIQVKFEAGRIVEAKASKG
EAVLNKVLDTDEGARRLGEVALVPHSSPISASGILFYNTLFDENASCHIALGQCYSKCFL
DGASLSQDQIKAQGGNSSLIHIDWMIGSNKVDIDGVKPDGSTVPVMRKGEWA