Protein Info for Atu0249 in Agrobacterium fabrum C58

Annotation: ABC transporter, substrate binding protein (sugar)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF03480: DctP" amino acids 54 to 325 (272 residues), 209 bits, see alignment E=4.9e-66

Best Hits

Swiss-Prot: 61% identical to TAKP_RHOS4: Alpha-keto acid-binding periplasmic protein TakP (takP) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: None (inferred from 100% identity to atu:Atu0249)

Predicted SEED Role

"TRAP transporter solute receptor, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKI0 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Atu0249 ABC transporter, substrate binding protein (sugar) (Agrobacterium fabrum C58)
MDRRSFIRKAGAVGAGVTATALAAPAIAQENPKITWRMTSSFTKGLDILFGAGQIVADHV
KEASGGNFVIQHFAGGEIVPALQAADAVTAGTVEMAHTCSYYYVGKDPTFALGTSVPFGL
NARQTNAWFNQAGGNELLNEFLAQHNIYSILLGNTGAQMGGWFRKEINTIDDLKGLKMRI
AGLTGQVMQKVGVTPQQIAGGDVYAALEKGTIDATEFVGPYDDQKLGFYKVAKYYYYPAW
WEGGPAVHAFVNLQKFNDLPENYKRILKDACAAGSASMLERYDARNPKALKELVAQGAIL
RPFSQEILDVCHKAAQDTYAEISAKNESFKKIYESQQAFKKDAYLWAQIAEYTYDTYMMI
QQRNGTL