Protein Info for Atu0248 in Agrobacterium fabrum C58

Annotation: transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details PF12833: HTH_18" amino acids 261 to 340 (80 residues), 78.2 bits, see alignment E=4.8e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0248)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKI1 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Atu0248 transcriptional regulator, AraC family (Agrobacterium fabrum C58)
MFVLFIPLPFVVGLLLVVMFIVFLRSGDDVRTNRAFLASIALCAVQSVLVGLRWGYGISE
MRYALPILAACLPPLIYIAFRGLMGAGVESRRVMLASLALSPLLIVVLEFAFPAAIDIAL
ITIFVGHAVALLLLGRKGPDGLDEAQFASVASAHRALIIAAVALCVSALFDLLVFFDFEW
AQGQNVAALVSNANLFGLLLIGLMAALAGKSKAPQTAAEPISDLSSPAEPSEQDRDIVAR
VDRLMEVQALYRDENLNLSRLARRLGLPSRQISGAINRSLGVNVSQYVNQLRIREACRLL
EETEQSVTAIMLSAGFQTKSNFNREFRRVTGMSPVDWREREVWKLVSNTKTATWQMPDGR
LRILK