Protein Info for Atu0246 in Agrobacterium fabrum C58

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF00583: Acetyltransf_1" amino acids 42 to 143 (102 residues), 53.3 bits, see alignment E=8.4e-18 PF13527: Acetyltransf_9" amino acids 44 to 145 (102 residues), 28.2 bits, see alignment E=4.5e-10 PF13673: Acetyltransf_10" amino acids 51 to 148 (98 residues), 40.7 bits, see alignment E=5.5e-14 PF13508: Acetyltransf_7" amino acids 61 to 145 (85 residues), 49.5 bits, see alignment E=1.1e-16 PF08445: FR47" amino acids 85 to 146 (62 residues), 32.2 bits, see alignment E=2.1e-11

Best Hits

Swiss-Prot: 41% identical to TTR_PSEAJ: Acetyltransferase (ttr) from Pseudomonas amygdali pv. tabaci

KEGG orthology group: None (inferred from 100% identity to atu:Atu0246)

MetaCyc: 41% identical to tabtoxinine-beta-lactam acetyltransferase (Pseudomonas syringae)
2.3.1.-

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKI3 at UniProt or InterPro

Protein Sequence (172 amino acids)

>Atu0246 acetyltransferase (Agrobacterium fabrum C58)
MATIRVLNGQETIDALPELCDVLAECVKGGASVGFMLPFSPRDAEPYWRSVAENVGEGGT
IHVVAEVDGRVVGTVQVGLASKPNQPHRGDLMKLLVHPEARGLGLARKLMEKAEQEAAAR
GRTLLVLDTATGSDAEAIYPRLGWQRVGVIPDYALFPDGRYCGTTLFYKRIG