Protein Info for Atu0234 in Agrobacterium fabrum C58

Annotation: conserved hypothetical protein, membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details PF00892: EamA" amino acids 6 to 130 (125 residues), 49.2 bits, see alignment E=3.3e-17 amino acids 152 to 283 (132 residues), 59.3 bits, see alignment E=2.7e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0234)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKJ0 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Atu0234 conserved hypothetical protein, membrane protein (Agrobacterium fabrum C58)
MDKTTSGWLNGLTGVVIFSGSLPATRLAVTGFDPVFLTAARASIAGLLALALLFLFRQKR
PARGDLTSLIIVSIGVVVGFPLLTALALRHVTSAHSIIFVGLLPLATAIFAVMRGGERPR
PVFWLFSCLGSALVAGFSLSNSFAARIEASLAGDLLMLGAIIVCGLGYAEGAALSRKLGG
WQVISWALVLSLPVMLPLAFFTGPETLGGIDPQAWGGLAYVSLFSMLIGFIFWYRGLALG
GIAAVGQLQLLQPFFGLALAATLLHEEVSPAMIGVTLVVVLCVAGARKFAR