Protein Info for Atu0223 in Agrobacterium fabrum C58

Annotation: components of type IV pilus, prepilin peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 92 to 118 (27 residues), see Phobius details PF01478: Peptidase_A24" amino acids 8 to 111 (104 residues), 67.3 bits, see alignment E=7.4e-23

Best Hits

KEGG orthology group: K02278, prepilin peptidase CpaA [EC: 3.4.23.43] (inferred from 100% identity to atu:Atu0223)

Predicted SEED Role

"Type IV prepilin peptidase TadV/CpaA" in subsystem Widespread colonization island

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKJ3 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Atu0223 components of type IV pilus, prepilin peptidase (Agrobacterium fabrum C58)
MIVAAIFLILPLCLCFAALNDLFSMTIPNVITVVLLLSFAFIAPFAGMDFQTFGLSLAGG
LIVFLGCFALFAANVMGGGDAKLLTGAAVWYGFNISLVEFLLAVTLVGGALTVGILLLRS
RSQEIMAFGIPIPDSLMVAQKIPYGIGIAIAGLLTYGEAPLVKAAIASIL