Protein Info for Atu0220 in Agrobacterium fabrum C58

Annotation: components of type IV pilus

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 TIGR02522: pilus (Caulobacter type) biogenesis lipoprotein CpaD" amino acids 2 to 186 (185 residues), 201.8 bits, see alignment E=4.9e-64 PF09476: Pilus_CpaD" amino acids 8 to 184 (177 residues), 197.2 bits, see alignment E=1.2e-62

Best Hits

KEGG orthology group: K02281, pilus assembly protein CpaD (inferred from 100% identity to atu:Atu0220)

Predicted SEED Role

"Flp pilus assembly protein CpaD" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKJ6 at UniProt or InterPro

Protein Sequence (193 amino acids)

>Atu0220 components of type IV pilus (Agrobacterium fabrum C58)
MTTNAIPDDYRTRHPITLSEAEHSLDIPVSAGDSRLTTAMADNVRGFAQNYASMSTGIVN
IQMPSGSPNSATAARMAKQIRSTLSGAGVAQGKIMETRYAASPNGDSAPIRLSYVAVTAM
TGQCGQWPEDLSDNTFANKNWYNFGCASQSNLAAQIANPMDLVGPRGMSPIDAERRAVVI
DTYRSGTATAPTN