Protein Info for Atu0209 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 80 to 105 (26 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 262 to 288 (27 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details amino acids 331 to 349 (19 residues), see Phobius details PF03741: TerC" amino acids 50 to 323 (274 residues), 70.8 bits, see alignment E=1.3e-23 PF04332: DUF475" amino acids 59 to 354 (296 residues), 350.6 bits, see alignment E=1e-108

Best Hits

KEGG orthology group: K09799, hypothetical protein (inferred from 100% identity to atu:Atu0209)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKK2 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Atu0209 hypothetical protein (Agrobacterium fabrum C58)
MSAAQKTTLSYFKWAFIVTVVGLILGGYLGWEMTGTIGGTATIFFICAVLAVLEISLSFD
NAIVNANKLKDMTPVWQHRFLTWGILIAVFGMRIVFPLLIVVVAANVGPWTALVMAATQP
ERYAEIMRDAHLPIAAFGGTFLMMVGLNFFFDHEKDVHWVRWIEEKAATYSSVKGIEIAF
VLIVMLVFSRIIGASDNPELGPVAANTFFHSAIWGLLTFLLVEVVGGILDRSQEMLEGAA
KGGFGAFLYLEVLDASFSFDGVIGAFALTQNLFIIAIGLGIGAMYVRSMTIMLVEKGTLA
EYRYLEHGAFYAILILSVIMYVQTMFHIPEVITGLGGATLIGISLWSSIRHNRQQSAGTA
DAARGAEI