Protein Info for Atu0208 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 99 to 116 (18 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details PF00892: EamA" amino acids 2 to 114 (113 residues), 40.1 bits, see alignment E=2.2e-14 amino acids 124 to 256 (133 residues), 43.8 bits, see alignment E=1.6e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0208)

Predicted SEED Role

"FIG028883: Permeases of the drug/metabolite transporter (DMT) superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1Y6 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Atu0208 hypothetical protein (Agrobacterium fabrum C58)
MGKWLVSTYSQGQVILIRSAAALVILVPIVWRAGLSGLVNVERPGLQVARVFFSTAELFC
FYFAVASLPLADVMTYWLAAPIYVAALAPFLLGEKVGWRRWTAIAIGFVGVLIALKPSSA
SLTSAALFSILGSAAFAFMMLSGRQLRNTPDTVLAFWQIIGAGLAGIVAVFMTPSGWLPV
QSSFDLAFLSLLGVVAMAAHVLVNRALKLADAATVAPLQYTLLLWAVIFGWLFFNDVPQT
SIVVGAGLIVFSGLYIFFRENTLKRRRDAADRLAAEQV