Protein Info for Atu0194 in Agrobacterium fabrum C58

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00890: FAD_binding_2
  • amino acids 46 to 78 (33 residues), 21.3 bits, see alignment (E = 2.1e-08)
• PF01266: DAO
  • amino acids 46 to 396 (351 residues), 230.4 bits, E=7.2e-72

Best Hits

Swiss-Prot: 53% identical to PUUB_ECOLI: Gamma-glutamylputrescine oxidoreductase (puuB) from Escherichia coli (strain K12)

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 100% identity to atu:Atu0194)

MetaCyc: 53% identical to gamma-glutamylputrescine oxidase (Escherichia coli K-12 substr. MG1655)
1.4.3.M3 [EC: 1.4.3.M3]

Predicted SEED Role

"FAD dependent oxidoreductase"

MetaCyc Pathways

• superpathway of L-arginine and L-ornithine degradation (8/13 steps found)
• superpathway of ornithine degradation (4/8 steps found)
• putrescine degradation II (1/4 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (6/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.- or 1.4.3.M3

Sequence Analysis Tools

See A9CKL1 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Atu0194 oxidoreductase (Agrobacterium fabrum C58)
MTPISGRCEMAEVTNIPNPGHTSSWYAASANVKSVRPTLEGALEADVCIIGGGFTGISAA
LELSERGYAVIVLEGVRVGFGASGRNGGQIVNGYSRDLETIARRYGHEKAVKLGEMSLEG
GTIIRSRVAKYGIDCDLVDGGFFAAFTPKQIREMEAHKAHWEKHGHGGLEMVSEADVGQY
VKTNRYAGGMIDRFGGHIHPLNLVQGEAAAAESLGARIFENSRVIAVEQGANPIVRTAMG
SVKAKYVLVCGNAYLGTLLPEIGERMMPVSSQVMATEPLDADLIEALLPANYCVEDANYI
LDYYRRTSDNRLLYGGGIGYGGSDPADLTGVIRPNMLKTFPQLEKTKIEFAWSGNFALTL
TRIPHMGRLSDNIYFSHGDSGHGVTTTHLLGKILGEAVAGHAERFDIWSSLPNYPFPGGK
TFRVPLTMLGAWWYGLRDKLGL