Protein Info for Atu0188 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (peptide)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 166 to 194 (29 residues), see Phobius details amino acids 222 to 245 (24 residues), see Phobius details amino acids 279 to 303 (25 residues), see Phobius details amino acids 327 to 352 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 150 to 357 (208 residues), 120 bits, see alignment E=5.2e-39

Best Hits

Swiss-Prot: 64% identical to YEJB_ECOLI: Inner membrane ABC transporter permease protein YejB (yejB) from Escherichia coli (strain K12)

KEGG orthology group: K13894, microcin C transport system permease protein (inferred from 100% identity to atu:Atu0188)

MetaCyc: 64% identical to putative oligopeptide ABC transporter membrane subunit YejB (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKL3 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Atu0188 ABC transporter, membrane spanning protein (peptide) (Agrobacterium fabrum C58)
MGAYILRRLALMIPTIVGIMGISFLVIQFAPGGPVEQVVAQLTGQGDSASDRLSGGGDLM
GQSGGFDESGSKYRGAQGLDPELIKKLEKQFGFDKPPLTRFLEMMWNYIRFDFGDSFFRN
SSVIDLIIDKLPVSASLGFWILIISYVISIPLGIKKAVSDGSTFDVWTSGIIIIGYAVPS
FLFGILLIVLFAGGSFFDWFPLRGLVSDNFDQLNWWQKIIDYFWHLTLPLIALSLSAFAT
TTLLTKNSFIDEIKKQYVVTARAKGLSERKVLYGHVFRNAMLIVIAGFPGAFISAFFTGS
LLIENIFSLDGLGRLGYLSVVNRDYPIVFGTLFIFSLMGLVVGLLSDLIYTWIDPRIDFE
RRDV