Protein Info for Atu0184 in Agrobacterium fabrum C58
Annotation: glucokinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to GLK_AGRFC: Glucokinase (glk) from Agrobacterium fabrum (strain C58 / ATCC 33970)
KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 100% identity to atu:Atu0184)Predicted SEED Role
"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)
MetaCyc Pathways
- glycolysis III (from glucose) (10/11 steps found)
- homolactic fermentation (10/12 steps found)
- sucrose degradation III (sucrose invertase) (4/4 steps found)
- glycogen degradation II (5/6 steps found)
- glucose and glucose-1-phosphate degradation (4/5 steps found)
- glycogen degradation I (6/8 steps found)
- Bifidobacterium shunt (11/15 steps found)
- UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
- GDP-α-D-glucose biosynthesis (2/3 steps found)
- trehalose degradation V (2/3 steps found)
- UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
- trehalose degradation I (low osmolarity) (1/2 steps found)
- trehalose degradation II (cytosolic) (1/2 steps found)
- sucrose biosynthesis II (5/8 steps found)
- heterolactic fermentation (12/18 steps found)
- trehalose degradation IV (1/3 steps found)
- 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
- chitin biosynthesis (5/9 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Galactose metabolism
- Glycolysis / Gluconeogenesis
- Nucleotide sugars metabolism
- Starch and sucrose metabolism
- Streptomycin biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.1.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8UIV7 at UniProt or InterPro
Protein Sequence (340 amino acids)
>Atu0184 glucokinase (Agrobacterium fabrum C58) MPKTSDTEYLSFPILLGDIGGTNARFSILIDSFAEPVHLTTVKTAEYPGIDDAIQQAVLD KTSLQPVSTILAIAGPIEGDEIPLTNCHWVVKPKDMLAKLGLKDVIVINDFEAQALAIAA LDDDNREPIGSGKKDMLASRVVLGPGTGLGVAGLVYARHMWFPVPGEGGHIDIGPRSARD YVVFPHIETIEGRVAGEQILCGRGLVNLYRAICKADGIEPVFSDPADITSQGLSGQNAQA KETLSLFSTYLGRVAGDLALIFMAKGGVYLAGGISQKIIPALKSPEFRAAFEDKAPHSAL MRTIPTFVVTHPQAALSGLATYARTPADFGLALDGRRWRA