Protein Info for Atu0181 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 TIGR03293: phosphonate C-P lyase system protein PhnG" amino acids 10 to 152 (143 residues), 175.2 bits, see alignment E=3.7e-56 PF06754: PhnG" amino acids 11 to 151 (141 residues), 174.6 bits, see alignment E=6.2e-56

Best Hits

Swiss-Prot: 58% identical to PHNG_RHIME: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG (phnG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06166, PhnG protein (inferred from 100% identity to atu:Atu0181)

Predicted SEED Role

"PhnG protein" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKL7 at UniProt or InterPro

Protein Sequence (153 amino acids)

>Atu0181 hypothetical protein (Agrobacterium fabrum C58)
MNNEAANIDSERKRVAALLARATVQELETVWSRQDASPQTENVRGPETGLVMVKGRIGGG
GAPFNLGETTVTRATVKLASGTVGHAHVLGTGRKKAWYAAVFDALWQESQTRGFIEAELL
SPVEKRLSEEKQRKTKETAATRVDFFTMVRGED