Protein Info for Atu0178 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF06007: PhnJ" amino acids 13 to 284 (272 residues), 485.1 bits, see alignment E=2.4e-150

Best Hits

Swiss-Prot: 90% identical to PHNJ_RHIME: Alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase (phnJ) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06163, PhnJ protein (inferred from 100% identity to atu:Atu0178)

MetaCyc: 90% identical to alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase (Sinorhizobium meliloti 1021)
RXN-17959 [EC: 4.7.1.1]

Predicted SEED Role

"PhnJ protein" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.7.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKM0 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Atu0178 hypothetical protein (Agrobacterium fabrum C58)
MLKEVSFDDGLAAYNFAYLDEQTKRMIRRAILKAIAIPGYQVPFASREMPMPYGWGTGGV
QLTASILGPDDVLKVIDQGADDTTNAVSIRAFFQKVADVAVTTRTKDATIIQTRHRIPEE
ELHSGQVLVYQVPIPEPLRFLEPRETETRVMHALEEYGLMHVKLYEDIARNGRISTTYAY
PVKVAGRYVMDPSPTPKFDNPKMNMSDALQLFGAGREKRIYAVPPYTDVVSLDFEDHPFE
IQRFDKPCALCGGENVYLDEVVLDDKGGRMFVCSDTDHCEDRRAHGHKGHLLADVKEAAE