Protein Info for Atu0153 in Agrobacterium fabrum C58

Annotation: transcriptional regulator, Fur family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 PF01475: FUR" amino acids 16 to 130 (115 residues), 73.4 bits, see alignment E=9.5e-25

Best Hits

KEGG orthology group: K09826, Fur family transcriptional regulator, iron response regulator (inferred from 99% identity to agr:AGROH133_03090)

Predicted SEED Role

"Iron-responsive regulator Irr" in subsystem Oxidative stress or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D233 at UniProt or InterPro

Protein Sequence (139 amino acids)

>Atu0153 transcriptional regulator, Fur family (Agrobacterium fabrum C58)
MAFDATLDIGTRLRRSGLRPTRQRVALGDLLFAKGDRHLTVEELHDEAVTAGVPVSLATV
YNTLHQFTEAGLIRVLAVEGARTYFDTNVSDHHHFFVEGENEVLDIPINNLQIDNLPEAP
EGMEIAHVDVVIRLRRKRG