Protein Info for Atu0142 in Agrobacterium fabrum C58

Annotation: cytochrome o ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 1 to 218 (218 residues), 364.6 bits, see alignment E=8.8e-114 PF00116: COX2" amino acids 132 to 198 (67 residues), 22.5 bits, see alignment E=9.3e-09 PF06481: COX_ARM" amino acids 218 to 263 (46 residues), 65.8 bits, see alignment 2.5e-22

Best Hits

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 100% identity to atu:Atu0142)

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D242 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Atu0142 cytochrome o ubiquinol oxidase subunit II (Agrobacterium fabrum C58)
MNPSGDVAIQQRDLIITSTVLMLLIIVPVIVLTLFFAWKYRESAKAEDYDPEWHHSTRLE
MVIWSAPVAIILMLGTVTWISTHRLDPYRPLERIDENRQVTADIKPITVEVVAMDWKWLF
FYPELGIGSVNEFAAPVDVPINFKITGTTAMNSFFVPALAGQIYAMGGMQTKLHAVINKE
GVYDGISANFSGPGFSHMRFKFHGLSQQGFDQWVAKVKEGGKGFGRQEYLEFAKPSEREP
VQYFASVDPELYSAILNRCVEPNKLCMRDMMHIDANGGGGKEGIDIAKALNSVVCTPLAP
YGVASGPQSTPAAIKGQTFEPAALPETKQVAG