Protein Info for Atu0139 in Agrobacterium fabrum C58

Annotation: cytochrome o ubiquinol oxidase subunit IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details TIGR02847: cytochrome o ubiquinol oxidase subunit IV" amino acids 23 to 119 (97 residues), 111.9 bits, see alignment E=8.5e-37 PF03626: COX4_pro" amino acids 30 to 103 (74 residues), 63.1 bits, see alignment E=1.3e-21

Best Hits

Swiss-Prot: 49% identical to CYOD_SHIFL: Cytochrome bo(3) ubiquinol oxidase subunit 4 (cyoD) from Shigella flexneri

KEGG orthology group: K02300, cytochrome o ubiquinol oxidase operon protein cyoD (inferred from 100% identity to atu:Atu0139)

MetaCyc: 49% identical to cytochrome bo3 subunit 4 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D245 at UniProt or InterPro

Protein Sequence (130 amino acids)

>Atu0139 cytochrome o ubiquinol oxidase subunit IV (Agrobacterium fabrum C58)
MSSEAHAHHDAHGDDHHHDGASHGTFKSYMIGFVLSVILTAIPFWLVMGGVLENKTLLVI
AIMGLGVIQIFVHMIYFLHMDTRSEGGWTFMALIFTVVVLLITLSGSLWVMYNMNKNMMP
LHIEDVKNLP