Protein Info for Atu0121 in Agrobacterium fabrum C58

Annotation: molecular chaperone, DnaJ family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 TIGR02349: chaperone protein DnaJ" amino acids 5 to 354 (350 residues), 448.9 bits, see alignment E=7.9e-139 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 94.9 bits, see alignment E=4.9e-31 PF01556: DnaJ_C" amino acids 124 to 338 (215 residues), 182.7 bits, see alignment E=9.3e-58 PF00684: DnaJ_CXXCXGXG" amino acids 151 to 211 (61 residues), 58.4 bits, see alignment E=1.4e-19 PF27439: DnaJ_C_2" amino acids 344 to 377 (34 residues), 49.5 bits, see alignment 6.9e-17

Best Hits

Swiss-Prot: 100% identical to DNAJ_AGRFC: Chaperone protein DnaJ (dnaJ) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 100% identity to atu:Atu0121)

MetaCyc: 57% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P50018 at UniProt or InterPro

Protein Sequence (377 amino acids)

>Atu0121 molecular chaperone, DnaJ family (Agrobacterium fabrum C58)
MAKADFYETLGVSKTADEKELKSAFRKLAMKFHPDKNPDDADSERKFKEINEAYETLKDP
QKRAAYDRFGHAAFENGGMGGGGMGGGGFANGGFSDIFEDIFGEMMGGGRARRSSGGRER
GADLRYNMEITLEEAFAGKTAQIRVPTSITCDVCSGSGAKPGTQPKTCATCQGSGRVRAA
QGFFSVERTCPTCHGRGQTISDPCGKCHGQGRVTEERSLSVNIPSGIEDGTRIRLQGEGE
AGMRGGPAGDLYIFLSVRPHEFFQRDGADLYCTVPISMTTAALGGTFDVTTLDGTKSRVT
VPEGTQPGKQFRLKGKGMPVLRSAQTGDLYIQIQIETPQKLSKRQRELLQEFEQLSSKEN
NPESTGFFARMKEFFDG