Protein Info for Atu0112 in Agrobacterium fabrum C58
Annotation: 50S ribosomal protein L32
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RL32_AGRFC: 50S ribosomal protein L32 (rpmF) from Agrobacterium fabrum (strain C58 / ATCC 33970)
KEGG orthology group: K02911, large subunit ribosomal protein L32 (inferred from 93% identity to mci:Mesci_1372)MetaCyc: 52% identical to 50S ribosomal subunit protein L32 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
No annotation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8UJ26 at UniProt or InterPro
Protein Sequence (61 amino acids)
>Atu0112 50S ribosomal protein L32 (Agrobacterium fabrum C58) MAVPKRKTSPSKRGMRRSADGLKSATYVEDKNSGELRRPHHIDLKTGMYRGRQVLTPKES A