Protein Info for Atu0080 in Agrobacterium fabrum C58

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details PF03547: Mem_trans" amino acids 5 to 309 (305 residues), 138.3 bits, see alignment E=1.2e-44

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to atu:Atu0080)

Predicted SEED Role

"Probable mdcF malonate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKQ8 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Atu0080 permease (Agrobacterium fabrum C58)
MSAVAANVAPIFILILIGWLTVKAGLLRADAGDILSDFVFKIAVPTLIFRTLAEANFHGA
SPFRLWITYFAGVAVTWAFGHIVTRYVFKQDVRIAVIAGISSAFANNIFIGLPLVGRSVG
DEGLVALSILLAIHLPVMMIAGTILMENATHKAVGGEKRGMAAVFKQVGRNLVTNPLVIG
LAIGLSTNVSGVALTPILKTVVDQVASMAGPAALISLGMALTKYTIRGNMGIAVTMTVFK
LLLLPACVWAMGHALGLSREWTAALVLTSSVPTGVNAWLIANRFGIGHSVAASTISISTA
TGVLSVSLWAWLLS