Protein Info for Atu0073 in Agrobacterium fabrum C58

Annotation: recF-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 TIGR00611: DNA replication and repair protein RecF" amino acids 6 to 363 (358 residues), 184.2 bits, see alignment E=2.1e-58 PF02463: SMC_N" amino acids 7 to 362 (356 residues), 75.4 bits, see alignment E=4.7e-25 PF13304: AAA_21" amino acids 31 to 342 (312 residues), 39.9 bits, see alignment E=5.5e-14

Best Hits

Swiss-Prot: 100% identical to RECF_AGRFC: DNA replication and repair protein RecF (recF) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 100% identity to atu:Atu0073)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UJ65 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Atu0073 recF-like protein (Agrobacterium fabrum C58)
MTNKVSLSRLKLTDFRNYAAAALVLDERHVVLTGDNGSGKTNLLEAVSFLSPGRGLRRAV
LSDVTRVGAEATGFSIFADVDGMDGEVAIGTGIEGDGEVVSRRLRLNGTPVKSVDELTDH
LRVLWLTPAMDGLFTGSSSDRRRFLDRLVLSLDPGHGRRASDFEKAMRGRNRLLSEGRFD
PVWLDGIEKQMAELGISMAVARYEMLGLLKTLIEGRAGNAAFPSATLSLAGFMDDRLNRP
AVDLEDEYGLMLRDGRYRDAAAGRTLDGPHRVDLFVRHAEKNMEAERCSTGEQKALLVGL
VLAHAQLTANMTGYAPVLLLDEIAAHLDEGRRAALFDLIHALGGQSFMTGTDAAMFSALG
ERAQFFNVSHGGITA