Protein Info for Atu0071 in Agrobacterium fabrum C58

Annotation: ribonucleoside-diphosphate reductase 2 beta chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 157 to 177 (21 residues), see Phobius details TIGR04171: ribonucleoside-diphosphate reductase, class 1b, beta subunit" amino acids 12 to 324 (313 residues), 479.1 bits, see alignment E=3e-148 PF00268: Ribonuc_red_sm" amino acids 14 to 285 (272 residues), 307.9 bits, see alignment E=3.6e-96

Best Hits

Swiss-Prot: 75% identical to RIR2_MYCLE: Ribonucleoside-diphosphate reductase subunit beta (nrdF) from Mycobacterium leprae (strain TN)

KEGG orthology group: K00526, ribonucleoside-diphosphate reductase beta chain [EC: 1.17.4.1] (inferred from 100% identity to atu:Atu0071)

MetaCyc: 78% identical to ribonucleoside-diphosphate reductase 2 subunit beta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ribonucleotide reductase of class Ib (aerobic), beta subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D292 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Atu0071 ribonucleoside-diphosphate reductase 2 beta chain (Agrobacterium fabrum C58)
MNIAVKPASRIRAVNWNRIEDDKDLEVWNRLTSNFWLPEKVPLSNDIPSWGTLKPEEQEL
TIRVFTGLTLLDTIQNGVGAVRLMPDSATPHEEAVLSNISFMEAVHARSYSSIFSTLCST
PDVDDAYRWSEENEFLQRKSAIIMREYDSGDPLKKKIASVFLESFLFYSGFYLPMFWSSR
AKLTNTADLIRLIIRDEAVHGYYIGYKFQRALDRLGEAQRQEIKDFAFDLLLELYDNEAK
YTEDLYDGVGLTEDVKQFLHYNANKALMNLGYEALFPAEACRVNPAILSALSPNADENHD
FFSGSGSSYVIGKAVATEDEDWDF