Protein Info for Atu0069 in Agrobacterium fabrum C58

Annotation: NrdI protein involved in ribonucleotide reduction

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00333: nrdI protein
  • amino acids 5 to 131 (127 residues), 159.5 bits, E=1.9e-51
• PF07972: Flavodoxin_NdrI
  • amino acids 5 to 123 (119 residues), 153.9 bits, E=1e-49

Best Hits

Swiss-Prot: 100% identical to NRDI_AGRFC: Protein NrdI (nrdI) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03647, protein involved in ribonucleotide reduction (inferred from 100% identity to atu:Atu0069)

Predicted SEED Role

"Ribonucleotide reduction protein NrdI" in subsystem Ribonucleotide reduction

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)

Sequence Analysis Tools

See Q8UJ69 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Atu0069 NrdI protein involved in ribonucleotide reduction (Agrobacterium fabrum C58)
MGLIVYYSSRSENTHRFLLKLERRLFRLPLGAEEDVPQVSEPYVLVTPTYGGGGTKGAVP
KPVIRFLNEPSNRNLIRGVIAAGNTNFGAAFASAGDIVSRKCAVPFLYRFELLGTEEDVA
NVKHGLERFWTR