Protein Info for Atu0069 in Agrobacterium fabrum C58

Annotation: NrdI protein involved in ribonucleotide reduction

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF07972: Flavodoxin_NdrI" amino acids 5 to 123 (119 residues), 153.9 bits, see alignment E=1e-49 TIGR00333: nrdI protein" amino acids 5 to 131 (127 residues), 159.5 bits, see alignment E=1.9e-51

Best Hits

Swiss-Prot: 100% identical to NRDI_AGRFC: Protein NrdI (nrdI) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03647, protein involved in ribonucleotide reduction (inferred from 100% identity to atu:Atu0069)

Predicted SEED Role

"Ribonucleotide reduction protein NrdI" in subsystem Ribonucleotide reduction

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UJ69 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Atu0069 NrdI protein involved in ribonucleotide reduction (Agrobacterium fabrum C58)
MGLIVYYSSRSENTHRFLLKLERRLFRLPLGAEEDVPQVSEPYVLVTPTYGGGGTKGAVP
KPVIRFLNEPSNRNLIRGVIAAGNTNFGAAFASAGDIVSRKCAVPFLYRFELLGTEEDVA
NVKHGLERFWTR