Protein Info for Atu0068 in Agrobacterium fabrum C58

Annotation: glutaredoxin protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 73 TIGR02194: glutaredoxin-like protein NrdH" amino acids 3 to 71 (69 residues), 102.8 bits, see alignment E=4.3e-34 PF00462: Glutaredoxin" amino acids 3 to 61 (59 residues), 57.5 bits, see alignment E=6.4e-20

Best Hits

Swiss-Prot: 44% identical to NRDH_SALTY: Glutaredoxin-like protein NrdH (nrdH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06191, glutaredoxin-like protein NrdH (inferred from 100% identity to atu:Atu0068)

MetaCyc: 59% identical to mycoredoxin 2 (Corynebacterium glutamicum ATCC 13032)

Predicted SEED Role

"Glutaredoxin-like protein NrdH, required for reduction of Ribonucleotide reductase class Ib" in subsystem Glutaredoxins or Glutathione: Redox cycle or Ribonucleotide reduction

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKR3 at UniProt or InterPro

Protein Sequence (73 amino acids)

>Atu0068 glutaredoxin protein (Agrobacterium fabrum C58)
MTVTVYSKPACVQCTATYRALDRIGVPYEIIDISEDTDALDHVRGLGYMQVPVVVAGERH
WAGFRPDMIGSIS