Protein Info for Atu0038 in Agrobacterium fabrum C58

Annotation: phosphoribosyl-ATP pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01503: PRA-PH
  • amino acids 6 to 92 (87 residues), 71.5 bits, E=5.8e-24
• TIGR03188: phosphoribosyl-ATP diphosphatase
  • amino acids 6 to 89 (84 residues), 99.3 bits, E=5.6e-33
• PF03819: MazG
  • amino acids 35 to 89 (55 residues), 26.5 bits, E=6.4e-10

Best Hits

Swiss-Prot: 100% identical to HIS2_AGRFC: Phosphoribosyl-ATP pyrophosphatase (hisE) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 100% identity to atu:Atu0038)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Sequence Analysis Tools

See Q8UJ91 at UniProt or InterPro

Protein Sequence (107 amino acids)

>Atu0038 phosphoribosyl-ATP pyrophosphohydrolase (Agrobacterium fabrum C58)
MSAFSLSDLERIVAKRAAASPDESWTAKLVAAGQERAAKKLGEEAVEAVIAAIAQDRDGL
KNEAADLLYHLLVVLKIADIPLSDVFAELERRTGQTGLAEKAARPTP