Protein Info for Atu0037 in Agrobacterium fabrum C58

Annotation: pantothenate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 TIGR00554: pantothenate kinase" amino acids 15 to 321 (307 residues), 414.9 bits, see alignment E=1.1e-128 PF00485: PRK" amino acids 95 to 253 (159 residues), 54.9 bits, see alignment E=5.4e-19

Best Hits

Swiss-Prot: 100% identical to COAA_AGRFC: Pantothenate kinase (coaA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00867, type I pantothenate kinase [EC: 2.7.1.33] (inferred from 100% identity to atu:Atu0037)

Predicted SEED Role

"Pantothenate kinase (EC 2.7.1.33)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UJ92 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Atu0037 pantothenate kinase (Agrobacterium fabrum C58)
MPGTLDHFRADEYSPYHFFSSEEWAKFRADTPLTLSADEVKRLRSLDDPIDLDEVRRIYL
SLSRLLSSHVEASQLLFEQRNRFLNMGDVNKTPFVIGIAGSVAVGKSTTARILKELLARW
PSSPKVDLITTDGFLYPNEVLRRENLMERKGFPESYDIGALLRFLSAIKAGQPNVKAPRY
SHLTYDVLPNEFTVIDQPDILIFEGINVLQSRDLPAGGRIVPIVSDFFDFSIYIDADEDF
IHNWYVNRFMNLRQTAFRDPNSFFNRYASISEEAALSIAEGLWQNINLKNLRQNIVPTRP
RADLILRKGENHLIDTVALRKL