Protein Info for Atu0031 in Agrobacterium fabrum C58

Annotation: PTS system, IIA component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 PF03610: EIIA-man" amino acids 3 to 114 (112 residues), 108.2 bits, see alignment E=1.4e-35

Best Hits

KEGG orthology group: K02793, PTS system, mannose-specific IIA component [EC: 2.7.1.69] (inferred from 98% identity to agr:AGROH133_02837)

Predicted SEED Role

"PTS system permease (IIAMan), nitrogen regulatory IIA protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKS4 at UniProt or InterPro

Protein Sequence (133 amino acids)

>Atu0031 PTS system, IIA component (Agrobacterium fabrum C58)
MIGLVLVTHGKLAEEFRHALEHVVGPQKLIETVCIGPEDDMDQRRQDIIDAVARANDGNG
VIILTDMFGGTPSNLAISVMNNGNVEVIAGVNLPMLIKLAGVRSEDNMDKALQDASDAGR
KYINVASRVLSGK