Protein Info for Atu0027 in Agrobacterium fabrum C58

Annotation: two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 881 transmembrane" amino acids 68 to 85 (18 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details PF12860: PAS_7" amino acids 393 to 504 (112 residues), 36.3 bits, see alignment E=1.7e-12 amino acids 521 to 634 (114 residues), 28.2 bits, see alignment E=5.4e-10 PF13188: PAS_8" amino acids 393 to 430 (38 residues), 19.4 bits, see alignment (E = 2.3e-07) amino acids 521 to 564 (44 residues), 15.8 bits, see alignment 3.2e-06 PF00512: HisKA" amino acids 650 to 717 (68 residues), 57.8 bits, see alignment 2.7e-19 PF02518: HATPase_c" amino acids 764 to 871 (108 residues), 92.2 bits, see alignment E=8.7e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0027)

Predicted SEED Role

"FIG056333: sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKS6 at UniProt or InterPro

Protein Sequence (881 amino acids)

>Atu0027 two component sensor kinase (Agrobacterium fabrum C58)
MTVHNSDLREQTVQRVENTHASVASSTRALERFCVFPDGKPAPTFSGNALARCRLAIRAI
RTGFSRARILLSGTVLTGSSTVAMAQDGLVAKTSARLFSSGETITYSLFVGMLSATLFSV
VWLVRQRGNIEAESSEYRQALAQSHHKIAKYEALISDKSRRIVIWDGVDKRPEFLGQLPA
ETGVPQADQDFLAFGRWLKPASAGQLEKSIEKLRSHAQSFDLTIETQRGEVIEVQGRVSG
GNAFARFIALNNLRAELAELQVERERLLASVSTFQELLDSIEQPVWRRNGEGELTWVNHA
YAHAVDARNAEQAVQEKRELLNTVTRQKIRAAATPESPYHDRISTVVSGNRSFFDVVDIK
TAGGSAGIAIDATEAETIREELKRVLKSHAETLDHLATPVAIFDGRQRLQFYNQAFASLW
GFDLVLLESGPDNSELLDRLRSAGKLPEQLNWKNWKETALSVYRSLDTKTDLWHLPNGQT
LRVIATAHPQGGATWVFENLTEQVDLQMRYNTLVKVQGETIDHLAEGVAVFGADGRIRLS
NPAFRALWGVTADEAETGTHIRAIETACAQSYDGPDGWRAFSQFITSFDDERPSRQGTLE
LLSGLVLDYAIIPLPDAQTMLTFVNMTDSVRAERALKEKNDALLKADELKNDFVQHVSYE
LRSPLTNIIGFTDLLKTPGIGQLTERQAEYLDHISTSSSVLLTIVNDILDLATVDAGIMQ
LNYSDNDLNELLDDVSVQIADRLQESGISLEIVAPAHLGSLVADHQRLKQILIKLLTNAI
NFAPEGSSVQLSCQRSEGDFVFSVADKGPGIPEDMLKSVFDRFATRGNGGRRTGAGLGLS
IVESFVSLHHGTVSIDSRPGNGTIVTCRIPSATLPHSIAAE