Protein Info for Atu0019 in Agrobacterium fabrum C58

Annotation: tryptophan synthase alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF00290: Trp_syntA" amino acids 9 to 254 (246 residues), 299.8 bits, see alignment E=5.9e-94 TIGR00262: tryptophan synthase, alpha subunit" amino acids 9 to 254 (246 residues), 247 bits, see alignment E=7.4e-78

Best Hits

Swiss-Prot: 100% identical to TRPA_AGRFC: Tryptophan synthase alpha chain (trpA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01695, tryptophan synthase alpha chain [EC: 4.2.1.20] (inferred from 100% identity to atu:Atu0019)

Predicted SEED Role

"Tryptophan synthase alpha chain (EC 4.2.1.20)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 4.2.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UJA9 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Atu0019 tryptophan synthase alpha subunit (Agrobacterium fabrum C58)
MTVRMDKRFADLRAENRPALITYFMGGDPDFQTSLGIMKALPEAGADVIELGMPFSDPMA
DGPAIQLAGQRALKGGQTLKTTLDLAREFRKQDNATPIVMMGYYNPIYIYGVEKFLDDAI
ASGIDGLIVVDLPPEMDDELCIPALARGINFIRLATPTTDGKRLPAVLKNTSGFVYYVSM
NGITGSALPDPSLISGAVGRIKAHTELPVCVGFGVKTADHAKAIGAVADGVVVGSAIVNQ
IAGSLTKDGQATADTVPAVTTLVKGLSTGVRASRLAAAE