Protein Info for Atu0015 in Agrobacterium fabrum C58

Annotation: intracellular PHB depolymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01849: polyhydroxyalkanoate depolymerase, intracellular
  • amino acids 1 to 394 (394 residues), 643.1 bits, E=8.1e-198
• PF06850: PHB_depo_C
  • amino acids 194 to 395 (202 residues), 334 bits, E=1.5e-104

Best Hits

KEGG orthology group: K05973, poly(3-hydroxybutyrate) depolymerase [EC: 3.1.1.75] (inferred from 100% identity to atu:Atu0015)

Predicted SEED Role

"Intracellular PHB depolymerase (EC 3.1.1.-)" in subsystem Polyhydroxybutyrate metabolism (EC 3.1.1.-)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Alkaloid biosynthesis II
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Glycerophospholipid metabolism
• Retinol metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.- or 3.1.1.75

Sequence Analysis Tools

See A9CKT2 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Atu0015 intracellular PHB depolymerase (Agrobacterium fabrum C58)
MAPLRAGADMMRQACNNPLNPLSSTAFGRSLDAGFEVFERLTRRYVKPEFDLGSTSVDGQ
TVVVTDETVWSRPFCSLVHFNRDLEPTRKPDPKVLLVAPMSGHYATLLRGTVEALLPSAD
IYITDWADARIVPATEGTFDLDDYIDYVIEMLRHIGPGAHVVAVCQPSVPVLAAVSLMEA
DGDTFAPASMTLMGGPIDTRINPTAVNGLATAKPIEWFRDNVVMQVPWPQPAFGRYVYPG
FLQLSGFMSMNLDKHMTAHKDFYLNLVKNDGDSAEKHREFYDEYLAVMDLTAEFYLQTVE
TVFIDHALPKGNMLHRGRAVDPTAIHNVALFTVEGENDDISGVGQTKAAHDLCRNIPEDK
RAHYMQPDVGHYGVFNGSRFRKEIVPRMLDFIGKHQMA