Protein Info for Atu0003 in Agrobacterium fabrum C58

Annotation: shikimate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08501: Shikimate_dh_N
  • amino acids 14 to 99 (86 residues), 86.9 bits, E=1.3e-28
• TIGR00507: shikimate dehydrogenase
  • amino acids 14 to 277 (264 residues), 225.5 bits, E=3.4e-71
• PF01488: Shikimate_DH
  • amino acids 129 to 200 (72 residues), 39 bits, E=1.3e-13
• PF18317: SDH_C
  • amino acids 249 to 276 (28 residues), 26.4 bits, see alignment (E = 6.8e-10)

Best Hits

Swiss-Prot: 100% identical to AROE_AGRFC: Shikimate dehydrogenase (NADP(+)) (aroE) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 100% identity to atu:Atu0003)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

See Q8UJC5 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Atu0003 shikimate 5-dehydrogenase (Agrobacterium fabrum C58)
MADSRETLTINAFVVGYPIKHSRSPIIHSYWLKKFGIAGSYTAVEVSPDDFPKFIATLKE
GKPGAAVGGNATIPHKEAAYRLADHPDALAEELGAANTIWMEEGKLHATNTDGYGFVSNL
DERHPGWDKTQRAVVFGAGGASRAVIQSLRDRDVAEIHVVNRTVERARELADRFGPRVFS
HPQAALQEVMHGAGLFVNTTSLGMNGTEAPHLDFSHLAANAVVTDIVYVPLKTPILNMAQ
EQGIATVDGLGMLLHQAKPGFRRWFGRIPEVDETLRSLIIADMEKH