Protein Info for AMB_RS24635 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 995 TIGR00229: PAS domain S-box protein" amino acids 71 to 187 (117 residues), 32.5 bits, see alignment E=4e-12 amino acids 329 to 452 (124 residues), 33 bits, see alignment E=2.9e-12 PF13188: PAS_8" amino acids 71 to 114 (44 residues), 18.4 bits, see alignment (E = 6.5e-07) PF13426: PAS_9" amino acids 79 to 181 (103 residues), 25.4 bits, see alignment E=5.9e-09 amino acids 343 to 444 (102 residues), 19.5 bits, see alignment E=4e-07 PF00512: HisKA" amino acids 465 to 530 (66 residues), 75.9 bits, see alignment 8.4e-25 PF02518: HATPase_c" amino acids 577 to 692 (116 residues), 94.5 bits, see alignment E=2.3e-30 PF00072: Response_reg" amino acids 728 to 839 (112 residues), 88.2 bits, see alignment E=1.8e-28 PF01627: Hpt" amino acids 894 to 961 (68 residues), 39.7 bits, see alignment 1.9e-13

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (995 amino acids)

>AMB_RS24635 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MNDKQQLEAERQMQDEEDLALRRLVSDGPGAGQRLLEETLHNLRVHEEELKAQNDELQQA
REDIEKQNNKNRDLFDCAPVGYFVLDDRLSIIDVNIAGLKLIGNDRAHVIGMPFRMFVDG
KVRQEVDGHFSMVRAHGNASTESRLAPHQKAPVPIILKSVRLGTEWGEGWRCLTTVMDIT
DRKVAEETAYRHSAELAITRDKLALIIDCMPQHIAVLDRHGVITLVNEAWRKFSIENGGS
STFCIGEYYGSVCGGMEASECPPQLTLHTLMDVITGQSPGISLEYPCHSPTEQRWFKLDI
SPISGVEPGAIVVHTNITSRKIMEMNVQNSRDRFSDFARSSSDWYWEMDENLIFTWFSER
FSYVTGLDPQEVIGKTREYLISEIAPESLVDHQGDLSARRPFRDFDYAIDTGRGKKYLRI
SGVPVFDKECGFIGYRGTGSDVTAIKEIEAQLRESKSVAEAANKAKSLFLANMSHEIRTP
MNGIIGMAHLALGGELPAKQRHHIQSIKQSAQRLLGIINDILDLSKAEAGKVVIDAAPFD
LANLIDEAISVVAAQASEKRLPINVRIASEVPRGVIGDPLRIRQILLNYLSNAVKFTSSG
GIDVDVQIEGGKTAPPTKLRFAVSDTGCGLTPEQQATLFQSFQQAEASTSAKFGGTGLGL
AIARQLAELMGGQAGVESQYGSGSTFWFTVQFQGAVDGVDCPSKFLSPIKIHNNFAHQDH
SILQGAQVLLAEDDLTNQMVAVGLLEAAGMLVDVVGNGAAAVEKAASGKYEIVLMDVRMP
GMDGITATRLIRENVELLDLPIVAMTANAMNEHKDECLAAGMSDFVSKPFQPEQLYGVIQ
NWVTGLAEASILGTAGMNAMSGRDLHVPSEIRGLNVRAGLRRVAGMKKLYLSSLQSFVQE
QGDIVLRLRRAIANRDFETAGRDAHTFKGLAGMIEAKEIVGITEDIEAGLEASDISRVMR
LVDNLEGLFLPLLASIKDAVGSSGLEFSNGDQSRG