Protein Info for AMB_RS24590 in Magnetospirillum magneticum AMB-1

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07721: TPR_4" amino acids 38 to 56 (19 residues), 10.2 bits, see alignment (E = 0.00061) amino acids 82 to 101 (20 residues), 12.1 bits, see alignment (E = 0.00015) PF13424: TPR_12" amino acids 81 to 146 (66 residues), 33.2 bits, see alignment E=2.6e-11 amino acids 202 to 273 (72 residues), 39.8 bits, see alignment E=2.4e-13 PF13432: TPR_16" amino acids 90 to 143 (54 residues), 17 bits, see alignment 3.9e-06 PF07719: TPR_2" amino acids 116 to 147 (32 residues), 23.5 bits, see alignment (E = 2.3e-08) PF13181: TPR_8" amino acids 117 to 146 (30 residues), 14.5 bits, see alignment (E = 1.8e-05) PF13374: TPR_10" amino acids 121 to 145 (25 residues), 15.9 bits, see alignment (E = 6e-06) amino acids 244 to 272 (29 residues), 15.2 bits, see alignment (E = 1e-05)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>AMB_RS24590 tetratricopeptide repeat protein (Magnetospirillum magneticum AMB-1)
MIRCFFRLLAAFVFFTTSPALAESWQEALSRANDLGRQGIAAHRAGKLDKAEQLLRSAIA
AIPADTPPNESDRVGIFLREKMAELMSTRGKPEEARQWLDQAKRFSRGDPYSKGHLLNDQ
GLLAYHQGKLDDAEEFYKQALSIFEKNRWNFDRAMTLGNLGLVYLDRYTRSDNIDHVQLN
NAEKAFAESLDVMLKYGSKVDIANQWSNLGIVYRNQNKLIQAENAHQEGLKIDREIGNKV
GEVDSLGNLGRVAKALGKSNEALTLFHEAYDLASDIHYARGISHHGLNAMALLNDRGLYR
MAEAYGEPTLAAAKGIGHNFTIARILEEMTTIAAKGHGCLAAARELAHESQGYFEAADLV
EDSQRLKRLLRDISAAKNQPWCK