Protein Info for AMB_RS23985 in Magnetospirillum magneticum AMB-1

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 774 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 314 to 324 (11 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details PF03924: CHASE" amino acids 104 to 298 (195 residues), 155.1 bits, see alignment E=2e-49 PF02518: HATPase_c" amino acids 660 to 769 (110 residues), 88.1 bits, see alignment E=5.4e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1043)

Predicted SEED Role

"Signal transduction histidine kinase HoxJ (hydrogenase regulation)" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8H8 at UniProt or InterPro

Protein Sequence (774 amino acids)

>AMB_RS23985 signal transduction histidine kinase (Magnetospirillum magneticum AMB-1)
MGVFPELNKIDYAQGRYVALPRSVVMAISQSAKIVRQLLPTSVMGVLSSLALFGIVFLVE
RDSSESRFAELAEQRIIAIRANIAIAQGSVNLLAAHFAVAPAGSTSREGFRRLVEQTLKD
HDFIQGYSWDPRVPHDQRALYEEVARGDGLNSFVFTERDAEGGLRPAVQRDEYIPIYYME
PMASNRPALGFDLASQPIRRLALEQGRDKGAPEATGRITLVQEHGGQYGVLILAPVFDKA
GPADPYSNRRSLTGYISGVFRLGDLISSSSSSAAVTMALPMVDIHLFDMSAAEGERRLFP
KQDSRTPDALAAGLHISESFAMAGRSWLLLATPSEAFVAASRPAASYVLLVVALLFTAFY
LLLLKSRIAQAEKATALAREMGRAKLRLGEAQRIAKLASVELDLSQGLFTTGDDAVEMLG
LPKSQTGGSVDFLLQCAHPDDRMMVRDALIGAADQAVDLEFRIEVGGEVRVLHALADDLA
EEGRSIITLQDITARKAAEEERAAMIERIAETDRFEALGTLAGGIAHEINTPTQYVGDNL
TFMKESQAELLELAQAVRLGARDDRDWQSIADKALALDLDFLATELPNAADQALDGTGQI
AKIVQAIKEFSYPSSKSAHPVDLNHMIDVVATVTRNQWKYVAEMDCDLDHDLPKVSAVEG
EINQVLVNLIVNAAQAIAEKGGDAPGRITVRTRRLESEVELSVTDTGIGIPAANLKQIFE
MFFTTKAPGQGTGQGLAISRSIIHRHGGQISAESQPGLGACFRIRLPLTQPQGA