Protein Info for AMB_RS23785 in Magnetospirillum magneticum AMB-1

Annotation: DNA gyrase inhibitor YacG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 56 PF03884: YacG" amino acids 9 to 50 (42 residues), 46.4 bits, see alignment E=1.3e-16

Best Hits

Swiss-Prot: 56% identical to YACG_AZOC5: DNA gyrase inhibitor YacG (yacG) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K09862, hypothetical protein (inferred from 100% identity to mag:amb3336)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1Y5 at UniProt or InterPro

Protein Sequence (56 amino acids)

>AMB_RS23785 DNA gyrase inhibitor YacG (Magnetospirillum magneticum AMB-1)
MTDETAPACAICGKPAQPKYKPFCSARCADVDLHRWLNESYRAPAVEDPEGLPEED