Protein Info for AMB_RS23595 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 890 transmembrane" amino acids 178 to 200 (23 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details PF00512: HisKA" amino acids 256 to 320 (65 residues), 74.7 bits, see alignment 1e-24 PF02518: HATPase_c" amino acids 367 to 482 (116 residues), 104.4 bits, see alignment E=9.9e-34 PF00072: Response_reg" amino acids 499 to 612 (114 residues), 42.7 bits, see alignment E=1.1e-14 amino acids 644 to 756 (113 residues), 95.7 bits, see alignment E=4.1e-31 PF01627: Hpt" amino acids 798 to 867 (70 residues), 50.4 bits, see alignment 4.3e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3735)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0T6 at UniProt or InterPro

Protein Sequence (890 amino acids)

>AMB_RS23595 hypothetical protein (Magnetospirillum magneticum AMB-1)
MLGSRATFEALRDKVSGVPQIDVATVVATNGDVVNFTRSYPPPPINLADRDYFKAHFADP
DLKFFLSLPAKNRGTGRWTFYLTRKIRNSHGATIGLVLTGIESAFLSEYYKAVNFSEFSA
ISLYRDDGGLLARMPERDDSMGKVLPQPGIQALRDGVETFITSEPRLVDQSDRRFRIVAP
RAVAGYPLAVIVAATEELVLADWRRKALMLGAGSGGLSLLLLGLMVWIARLLDNRETAMA
TARQAQQVAERANQAKAAFLATMSHEIRTPMNGVIGMTGLLLDTQLDPEQRHFATTIRDS
AESLLTVINDILDFSKLEAGKLDLESTDFELVGLVESIVDILAPRAHAKGIEIASMVDPD
LPAWVRGDPGRLRQILMNLAGNAIKFTSHGGISIEVRDETSPDGAGRLRFDVRDTGIGIP
QDAIGRLFSMFMQVDASTARRYGGTGLGLAISKRLTEMMGGTIGVESTPGAGSLFWFSLP
FQMVETAPPQRPDLAGRRILVVDDSPINRDVLERQLRGFGVIVASCADAESALAELGRAA
ATGTPWEAAIIDARMPGVTGSDLIGRIRAEPVLAPMGLIIASSQGLSPEDGSPKADAFIH
KPLRRQTILAVLARVLGLPHDPGLQDSPESEPEAIPRPARRLRILVAEDNPVNQQVAVGL
LRKLGHSVDVAADGAEAVEAVRSRPYDLVLMDVQMPEMDGLQATAAIRALTGGAERVPIV
AMTANAMRGDDRMCLDAGMDRYISKPIDRRKLMEVLAQYAAEPPAAKPPQAENPAPSAVE
IDVLDLLCEDLGVETVVEILAKFFEDATSREAECAAALAREDHERVRREAHAIKGAAASL
GLTDIRRTAEAMEAAVRSGAPIAAPLAALSDAIVRLPAVLAGSAYALPRD