Protein Info for AMB_RS23210 in Magnetospirillum magneticum AMB-1

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 810 PF00534: Glycos_transf_1" amino acids 195 to 350 (156 residues), 81.5 bits, see alignment E=1.7e-26 PF13692: Glyco_trans_1_4" amino acids 202 to 335 (134 residues), 69.7 bits, see alignment E=1e-22 PF13524: Glyco_trans_1_2" amino acids 224 to 365 (142 residues), 28.2 bits, see alignment E=5.1e-10 PF13641: Glyco_tranf_2_3" amino acids 384 to 505 (122 residues), 45.3 bits, see alignment E=2.7e-15 PF00535: Glycos_transf_2" amino acids 386 to 507 (122 residues), 104.7 bits, see alignment E=1.6e-33 PF10111: Glyco_tranf_2_2" amino acids 387 to 525 (139 residues), 41.2 bits, see alignment E=4.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1081)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8E0 at UniProt or InterPro

Protein Sequence (810 amino acids)

>AMB_RS23210 glycosyl transferase (Magnetospirillum magneticum AMB-1)
MREAIKPRGLRIAIDTRSLVVGVSGGIIQNQVGVFRELFKRYPEHTYFVFCTPFNREIFR
ELSDHIHLVSLPPSSYLHDLAQTLQTRKIDVLFRSYPTADAAVFPMERQIIYIPDNQHDY
YPQFFSRDARAYRKLAFDKTLREAGAVGTISEFSRSTLQAHPECACSDIFLMAPALQEEH
SLARAEDLTAEELAQVPDGDFFIYPANLWEHKNHRRVLEAFSRLLAETNHKISFIFTGNP
ADWPSISRGFEALPICHLGYVRAELVQYLLQKARALVFFSLFEGFGIPLLEAFHAGTPVL
CSNCTSLPEVAGDATLLADPLDISSMAAAMRQILESPALTAELVERGRRRLDAFTWAQSA
DNLMAAFVRVAGRTVRSPLDLQPLVSVVTPSYNQGRFIRRTIESVLNQTYGNIEYQVIDG
GSDDETVDILKSYGGRFHWVSEPDGGQTAAINKGLAQAKGEILCYLNSDDVLEPDALEKV
VDFFLKNPECDLVYGKAHYIDENDAVIGSYKTSDRPSDLHTDCIICQPAAFWRAGLSKLI
GQFDETISTAMDYDYWLRAVNAHAVISHLPEYIASSRLYAETKTMAQRELIFHECFDLCA
RHVGYVHAHYFFGYWHWKLIERRPWMAPFFRFFPLAWKLPARISHAYFLLRRGLLPRAFK
GKLRLMAQHPSVRGGILRVLLRLRERLRHRRLPRGPHNGLTVFGAWSDCWLAPEVEICGN
WRSGKKAIRLGGFVPTDCTMRLSLNHAMVIERRLEGNREHMVEFSLDFAEGSNIVTLSFD
AWISDTLRDLSFCIYETNLFCETDILVPAK