Protein Info for AMB_RS23155 in Magnetospirillum magneticum AMB-1

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details PF00512: HisKA" amino acids 140 to 204 (65 residues), 40.4 bits, see alignment E=2.4e-14 PF02518: HATPase_c" amino acids 249 to 359 (111 residues), 89.9 bits, see alignment E=1.5e-29

Best Hits

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>AMB_RS23155 two-component sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MAIYGSEYAYYFFIDDNFKMRLLCYLLAYSVTSLWAFTVTISEFRKTRMTSYLAASAFLL
FLSISFLVSAALSNPSDRVKDIYSLTAINASVVFEQIIFVIGWIISFILMVNERLIDEKN
QVQNALNDKNIILEQSNADLEQFAYVASHDLQTPLSNMVRYAQLLEHRYSGKIDSDADDF
LRFIAEGGKHMTNLIYDLLAFSRTSQQLELLRPIPAGDAIARALKNLELDLHASGAEVTV
GDLPTVIADQTHLVSLFQNLLSNAIKYSAPDRRPVLSVSAERMPSNDWRFAVSDNGIGIE
SQYHGKIFEIFQRLDPMSYKDGTGIGLTLCRRIVHRFGGEIWLESELGEGTTFFFTLKDG
ADQS