Protein Info for AMB_RS22935 in Magnetospirillum magneticum AMB-1

Annotation: imidazole glycerol phosphate synthase subunit HisH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR01855: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit" amino acids 5 to 213 (209 residues), 196.6 bits, see alignment E=2e-62 PF00117: GATase" amino acids 7 to 211 (205 residues), 75.9 bits, see alignment E=3.3e-25

Best Hits

Swiss-Prot: 60% identical to HIS5_RHORT: Imidazole glycerol phosphate synthase subunit HisH (hisH) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02501, glutamine amidotransferase [EC: 2.4.2.-] (inferred from 100% identity to mag:amb4533)

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYI8 at UniProt or InterPro

Protein Sequence (216 amino acids)

>AMB_RS22935 imidazole glycerol phosphate synthase subunit HisH (Magnetospirillum magneticum AMB-1)
MTGIVAIIDYGSGNLRSAAKAFERVVAEASLNLSVAVTNDPKVVDRADRVVLPGVGAFAD
CRAGLLALPGMAETLTERVLARGVPFFGICVGMQLMASIGREHGLHAGLGWVAGEVVPLG
VEDQGLKVPHMGWNQLVPDGLSHPLLAGLDSEAHAYFVHSYKFEPANPAHRLAHVEYGGQ
VTAVVGRDNMVGTQFHPEKSQITGLKVISNFLTWTP