Protein Info for AMB_RS22780 in Magnetospirillum magneticum AMB-1

Annotation: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 PF00590: TP_methylase" amino acids 50 to 249 (200 residues), 105.3 bits, see alignment E=4.5e-34 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 50 to 315 (266 residues), 257.6 bits, see alignment E=7e-81 PF23016: RsmI_C" amino acids 288 to 317 (30 residues), 33.3 bits, see alignment (E = 3.5e-12)

Best Hits

Swiss-Prot: 45% identical to RSMI_HAEIN: Ribosomal RNA small subunit methyltransferase I (rsmI) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07056, (no description) (inferred from 100% identity to mag:amb4502)

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYL9 at UniProt or InterPro

Protein Sequence (324 amino acids)

>AMB_RS22780 16S rRNA (cytidine(1402)-2'-O)-methyltransferase (Magnetospirillum magneticum AMB-1)
MAGQRRSAGKSRDGARGSSSDDGPGALEPGGETEAKSRPWARGSKPSAGLYLVATPIGNL
GDITLRALEVLGHADLVACEDTRVTGRLMQLLGLKAPLAPYHDHNADRARPGLLARLRQG
EVVALVSDAGTPMVSDPGFKLVRDCIESDIAVTALPGASAVLTALQLSGIASERFLFAGF
LPSKGAARRAALQELALVPASLVFYESPHRTGESLADMVTVLGDRQGAVTRELTKLHEEV
VRGSLSELALRFAETPPRGEVAIVVSGPRAEGGAPQDIEGRLHLEIEKGLSIKDASALVA
AETGHPRRDVYATALRLFRGSNEE