Protein Info for AMB_RS22740 in Magnetospirillum magneticum AMB-1

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 PF13188: PAS_8" amino acids 23 to 75 (53 residues), 28.8 bits, see alignment 3e-10 amino acids 149 to 191 (43 residues), 32.1 bits, see alignment 2.7e-11 TIGR00229: PAS domain S-box protein" amino acids 23 to 144 (122 residues), 54.8 bits, see alignment E=1e-18 amino acids 146 to 268 (123 residues), 44.4 bits, see alignment E=1.8e-15 PF00989: PAS" amino acids 23 to 132 (110 residues), 25.5 bits, see alignment E=3.9e-09 amino acids 149 to 224 (76 residues), 33.2 bits, see alignment E=1.6e-11 PF13426: PAS_9" amino acids 34 to 136 (103 residues), 32.9 bits, see alignment E=2.3e-11 amino acids 156 to 260 (105 residues), 44.5 bits, see alignment E=5.8e-15 PF08447: PAS_3" amino acids 44 to 131 (88 residues), 33.1 bits, see alignment E=1.9e-11 PF08448: PAS_4" amino acids 151 to 264 (114 residues), 32.8 bits, see alignment E=2.4e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 271 to 427 (157 residues), 135.1 bits, see alignment E=1.9e-43 PF00990: GGDEF" amino acids 273 to 427 (155 residues), 161 bits, see alignment E=7.7e-51 PF00563: EAL" amino acids 449 to 684 (236 residues), 244.5 bits, see alignment E=3.4e-76

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (703 amino acids)

>AMB_RS22740 GGDEF domain-containing protein (Magnetospirillum magneticum AMB-1)
MDSDAMSGDVLVLARNDDDLGGYRSLFENAVEGIYRTTPDGRYLDANPALARIYGYKDPA
ELIAGLTDIARGLYVDPADRERFREILARDSVVRNFEARVRTRSGEIIWIAENARAVYDG
RDRLVCYEGTVQNITARKQAEESLRLAATVFETVGEAIVVTDRERRILAVNAAFERMTGW
NAAEMVGQTCDLLAVEMIGLREIEEMWRLAANTGQWSGETWTRRKESEPFPAALALTAVD
QGADAKGEDGRFVLLLRDITRKRRDEQRIRFHASHDALTRLPNRHTVMEALGEAIVRAEQ
TGERLAVLYLDVNRFKDINDSYGHAVGDELLRQVARRLKACVRASDVIGRLGGDEFVMLL
PSVGDHTAAQACANKVLYAFAEPFDMEGLQLFAGTSIGIALYPDDADGAESLLSRADAAM
YHAKRGGLPYSCFDIEMDRQVAERVSLENDLRLALGEDQFRLVYQPKVDALSGAIIGAEA
LIRWRHPVRADVSPGLFIPVAERAGLIGAIDDWVLVEACRQVAEWRAQGLILPSISVNLS
PAQFHDGRLKEKVKAALAGSGLPPSVLELEITETMMASDVDRAIEILGQLTTLGVRVSLD
DFGTGYSSLAYLKLFPVSTLKIDRAFVTELPGNAKDGAIIASVIALAGNLGFSVIAEGVE
TREQAAFLAARGCPIMQGFLFSRPVNAATFAGLLSNPEGLIRL