Protein Info for AMB_RS22725 in Magnetospirillum magneticum AMB-1

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01048: diaminopimelate decarboxylase
  • amino acids 6 to 415 (410 residues), 470.3 bits, E=2.1e-145
• PF00278: Orn_DAP_Arg_deC
  • amino acids 29 to 373 (345 residues), 97.9 bits, E=5e-32
• PF02784: Orn_Arg_deC_N
  • amino acids 36 to 281 (246 residues), 196.8 bits, E=6.2e-62
• PF01168: Ala_racemase_N
  • amino acids 38 to 236 (199 residues), 35.8 bits, E=1.1e-12

Best Hits

Swiss-Prot: 47% identical to DCDA_ZYMMO: Diaminopimelate decarboxylase (lysA) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 100% identity to mag:amb4491)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (15/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

See Q2VYN0 at UniProt or InterPro

Protein Sequence (424 amino acids)

>AMB_RS22725 diaminopimelate decarboxylase (Magnetospirillum magneticum AMB-1)
MNHFHYQNGELFAEDVAIARIAREVGTPFYCYSTATLQRHYTVFAEALKAAGLDATICFA
AKANPNMAVIRTFAQLGAGADVVSEGELRQALAAGVPAARIVFSGVGKTRHELEFAVAKG
IFQINVESEPELEMLSEIAAARGQVMPIAIRVNPDVDAGTHAKITTGKKENKFGIEWTRA
REVYARAKALPGVEPVAIACHIGSQLTELTPFREAFLRVRDLVAMLRADGIDIRRLDLGG
GLGVPYDDETPPEPAAYAEVIKATLGDLGCRFVFEPGRLLVGNAGILVSRIIRVKEGSTR
TFLIVDAAMNDLARPSLYDAYHSIFPVAEPKAGAALAEVDVVGPVCETGDTFAKQRRLPP
MRTDDLLAFGTAGAYGAAMSSTYNTRPLIPEVLVKGGDYAVIRVRPSYEDMRSLESLPGW
LNDE