Protein Info for AMB_RS22340 in Magnetospirillum magneticum AMB-1

Annotation: DNA mismatch repair protein MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 607 TIGR00585: DNA mismatch repair protein MutL" amino acids 1 to 310 (310 residues), 296.8 bits, see alignment E=1.3e-92 PF02518: HATPase_c" amino acids 22 to 77 (56 residues), 30.2 bits, see alignment 1.1e-10 PF13589: HATPase_c_3" amino acids 24 to 125 (102 residues), 43.7 bits, see alignment E=5.9e-15 PF01119: DNA_mis_repair" amino acids 212 to 329 (118 residues), 130.4 bits, see alignment E=5.3e-42 PF08676: MutL_C" amino acids 423 to 564 (142 residues), 160.4 bits, see alignment E=4.8e-51

Best Hits

Swiss-Prot: 100% identical to MUTL_MAGSA: DNA mismatch repair protein MutL (mutL) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 100% identity to mag:amb4416)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2VYV5 at UniProt or InterPro

Protein Sequence (607 amino acids)

>AMB_RS22340 DNA mismatch repair protein MutL (Magnetospirillum magneticum AMB-1)
MSIRLLPPTLVNQIAAGEVVERPASAVKELVENAIDAGASRIDVVLAEGGQSLIAVSDDG
CGMSPDEMMLAVERHATSKLPDDDLVRIRFLGFRGEALPSIGSVARLTLTSRPRGADSAW
SLSVEGGAKGRPVPAAHPQGTRIEVRDLFYATPARLKFLKAARTELTHAADVIERLGMAH
PDIAFSLSDGGRKVLDLAAKRGEPGAALLSRIAQVVGREFEPNALALDAERDGVRLTGWA
GLPTYNRATSAAQYLFVNGRPVKDRLVIGAVRGAYQDVLARDRHPVVALFLELDPDQVDV
NVHPAKAEVRFRDSGLVRGLIVGAIRHALAGAGHRASSTLTGVALGALGGGGGNSPPPSF
AHYPPPRPSLPLIRAGIGAQAPLGLAEQGLGLHLPPAAPVAPPEAREGPGEASVDYPLGA
AKAQLHDTYIVAETADGLVIVDQHAAHERLVFERLKLGLTEGQVARQGLLLPEVVDLGDA
GAARVTERAGDLARLGLVIDSFGPGAVVVREVPALLGDDDVQGLVRDLADELAEWGASTV
LEERLLHICATMACHGSVRAGRRLSVPEMNALLRRMEATPLSGQCNHGRPTHVSLSLNDI
EKLFGRR